Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

2,866 – 2,880 of 115,723 results

2,866

Novus Biologicals™ ARL4 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,867

R&D Systems™ Recombinant Human BID (Caspase-8-cleaved) Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

Pricing & Availability

2,868

MP Biomedicals™ ImmunO™ Prostate Specific Antigen (PSA)

Filter sterilized

Pricing & Availability

2,869

R&D Systems™ Recombinant Human MSP/MST1 (CHO-expressed) Protein, CF

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

2,870

Novus Biologicals™ Recombinant Human OAZ1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,871

Novus Biologicals™ Recombinant Human Proapoptotic Caspase Adaptor Protein His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	caspase-2 binding protein, FLJ32987, HSPC190, marginal zone B and B1 cell-specific protein, MGC29506, PACAP, pERp1, plasma cell-induced ER protein 1, plasma cell-induced resident endoplasmic reticulum protein, Plasma cell-induced resident ER protein, Proapoptotic caspase adapter protein, proapoptotic caspase adaptor protein
Common Name	Proapoptotic Caspase Adaptor Protein
Molecular Weight (g/mol)	TMW: 12.9kDa
Gene ID (Entrez)	51237
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

2,872

R&D Systems™ Recombinant Human CDO Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

2,873

R&D Systems™ Recombinant Human ASAHL Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

2,874

R&D Systems™ Recombinant Human Glyoxalase I Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

Pricing & Availability

2,875

R&D Systems™ Recombinant Human Desmocollin-2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

2,876

R&D Systems™ Recombinant Mouse CCL12/MCP-5 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	9.3 kDa
Gene ID (Entrez)	20293
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived mouse CCL12/MCP-5 protein Gly23-Gly104
Recombinant	Recombinant
Name	CCL12/MCP-5

2,877

Novus Biologicals™ DUSP19 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,878

Novus Biologicals™ Recombinant Human FIH-1/HIF-1AN Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,879

Novus Biologicals™ PSMG3 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	PSMG3
Molecular Weight (g/mol)	15.2kDa
Gene ID (Entrez)	84262
Formulation	Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Immunogen	PSMG3, 1-122aa. MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

2,880

Novus Biologicals™ Recombinant Human KLF6 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	BCD1Zf9, B-cell-derived protein 1, COPEBCBA1, core promoter element binding protein, Core promoter element-binding protein, CPBPZF9, DKFZp686N0199, EC 2.1.1.43, EC 6.1.1.15, GBF, GC-rich binding factor, GC-rich sites-binding factor GBF, Krueppel-like factor 6, Kruppel-like factor 6, Kruppel-like zinc finger protein Zf9, PAC1, Proto-oncogene BCD1, protooncogene B-cell derived 1, ST12, suppression of tumorigenicity 12 (prostate), Suppressor of tumorigenicity 12 protein, Transcription factor Zf9
Common Name	KLF6
Molecular Weight (g/mol)	TMW: 34.3kDa
Gene ID (Entrez)	1316
Formulation	20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

Prev
1
...
190
191
192
193
...
7,715
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ ARL4 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human OAZ1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Proapoptotic Caspase Adaptor Protein His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ DUSP19 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human FIH-1/HIF-1AN Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PSMG3 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human KLF6 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ARL4 Protein

Novus Biologicals™ Recombinant Human OAZ1 His Protein

Novus Biologicals™ Recombinant Human Proapoptotic Caspase Adaptor Protein His Protein

Novus Biologicals™ DUSP19 Protein

Novus Biologicals™ Recombinant Human FIH-1/HIF-1AN Protein

Novus Biologicals™ PSMG3 Protein

Novus Biologicals™ Recombinant Human KLF6 His Protein